Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,771
  2. Avatar for Go Science 2. Go Science 63 pts. 10,670
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,657
  4. Avatar for Contenders 4. Contenders 21 pts. 10,653
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 10,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,535
  7. Avatar for HMT heritage 7. HMT heritage 2 pts. 10,505
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,450
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,361
  10. Avatar for Russian team 10. Russian team 1 pt. 10,003
  1. Avatar for ttisor1 121. ttisor1 Lv 1 1 pt. 8,752
  2. Avatar for oaadepoju 122. oaadepoju Lv 1 1 pt. 8,691
  3. Avatar for lamoille 123. lamoille Lv 1 1 pt. 8,532
  4. Avatar for Joeymorrison14 124. Joeymorrison14 Lv 1 1 pt. 8,465
  5. Avatar for stevemh 125. stevemh Lv 1 1 pt. 8,373
  6. Avatar for jcferrel 126. jcferrel Lv 1 1 pt. 8,324
  7. Avatar for 01010011111 127. 01010011111 Lv 1 1 pt. 7,981
  8. Avatar for asb4 128. asb4 Lv 1 1 pt. 7,798
  9. Avatar for leysanguyen 129. leysanguyen Lv 1 1 pt. 7,405
  10. Avatar for bkoep 130. bkoep Lv 1 1 pt. 7,312

Comments