Placeholder image of a protein
Icon representing a puzzle

1577: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 7 years ago

Novice Overall Prediction

Summary

Created
September 26, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,771
  2. Avatar for Go Science 2. Go Science 63 pts. 10,670
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 10,657
  4. Avatar for Contenders 4. Contenders 21 pts. 10,653
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 11 pts. 10,629
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 5 pts. 10,535
  7. Avatar for HMT heritage 7. HMT heritage 2 pts. 10,505
  8. Avatar for Marvin's bunch 8. Marvin's bunch 1 pt. 10,450
  9. Avatar for Gargleblasters 9. Gargleblasters 1 pt. 10,361
  10. Avatar for Russian team 10. Russian team 1 pt. 10,003
  1. Avatar for anushb22 111. anushb22 Lv 1 1 pt. 9,283
  2. Avatar for NotJim99 112. NotJim99 Lv 1 1 pt. 9,170
  3. Avatar for kasper2421 113. kasper2421 Lv 1 1 pt. 9,129
  4. Avatar for Alexei2511 114. Alexei2511 Lv 1 1 pt. 9,099
  5. Avatar for emtonsti 115. emtonsti Lv 1 1 pt. 9,064
  6. Avatar for demeter900 116. demeter900 Lv 1 1 pt. 9,038
  7. Avatar for flemdogmillionaire 117. flemdogmillionaire Lv 1 1 pt. 9,027
  8. Avatar for Arne Heessels 118. Arne Heessels Lv 1 1 pt. 8,959
  9. Avatar for Stein Jr. 119. Stein Jr. Lv 1 1 pt. 8,835
  10. Avatar for Enderoreo 120. Enderoreo Lv 1 1 pt. 8,800

Comments