Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053

  1. Avatar for guineapig 21. guineapig Lv 1 45 pts. 9,874
  2. Avatar for Vinara 22. Vinara Lv 1 43 pts. 9,864
  3. Avatar for phi16 23. phi16 Lv 1 42 pts. 9,848
  4. Avatar for Marvelz 24. Marvelz Lv 1 40 pts. 9,807
  5. Avatar for Wojcimierz 25. Wojcimierz Lv 1 38 pts. 9,802
  6. Avatar for Bautho 26. Bautho Lv 1 36 pts. 9,797
  7. Avatar for silent gene 27. silent gene Lv 1 35 pts. 9,765
  8. Avatar for MurloW 28. MurloW Lv 1 33 pts. 9,763
  9. Avatar for tyler0911 29. tyler0911 Lv 1 32 pts. 9,756
  10. Avatar for MicElephant 30. MicElephant Lv 1 30 pts. 9,738

Comments