Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053
  1. Avatar for pvc78 41. pvc78 Lv 1 18 pts. 9,622
  2. Avatar for YeshuaLives 42. YeshuaLives Lv 1 17 pts. 9,621
  3. Avatar for TastyMunchies 43. TastyMunchies Lv 1 16 pts. 9,615
  4. Avatar for robgee 44. robgee Lv 1 15 pts. 9,608
  5. Avatar for katling 45. katling Lv 1 14 pts. 9,595
  6. Avatar for WBarme1234 46. WBarme1234 Lv 1 14 pts. 9,588
  7. Avatar for johnmitch 47. johnmitch Lv 1 13 pts. 9,585
  8. Avatar for Glen B 48. Glen B Lv 1 12 pts. 9,583
  9. Avatar for heather-1 49. heather-1 Lv 1 12 pts. 9,572
  10. Avatar for Hellcat6 50. Hellcat6 Lv 1 11 pts. 9,563

Comments