Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary


Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053

  1. Avatar for Deleted player 61. Deleted player pts. 9,243
  2. Avatar for jamiexq 62. jamiexq Lv 1 5 pts. 9,182
  3. Avatar for Steven Pletsch 63. Steven Pletsch Lv 1 5 pts. 9,140
  4. Avatar for jausmh 64. jausmh Lv 1 5 pts. 9,131
  5. Avatar for isaksson 65. isaksson Lv 1 5 pts. 9,128
  6. Avatar for Flagg65a 66. Flagg65a Lv 1 4 pts. 9,109
  7. Avatar for boondog 67. boondog Lv 1 4 pts. 9,106
  8. Avatar for Phyx 68. Phyx Lv 1 4 pts. 9,106
  9. Avatar for andrewxc 69. andrewxc Lv 1 4 pts. 9,075
  10. Avatar for rinze 70. rinze Lv 1 3 pts. 9,062

Comments