Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053
  1. Avatar for Skippysk8s 31. Skippysk8s Lv 1 29 pts. 9,738
  2. Avatar for toshiue 32. toshiue Lv 1 28 pts. 9,734
  3. Avatar for vakobo 33. vakobo Lv 1 26 pts. 9,704
  4. Avatar for crpainter 34. crpainter Lv 1 25 pts. 9,693
  5. Avatar for Mike Cassidy 35. Mike Cassidy Lv 1 24 pts. 9,681
  6. Avatar for diamonddays 36. diamonddays Lv 1 23 pts. 9,673
  7. Avatar for aznarog 37. aznarog Lv 1 22 pts. 9,671
  8. Avatar for hpaege 38. hpaege Lv 1 21 pts. 9,668
  9. Avatar for fpc 39. fpc Lv 1 20 pts. 9,644
  10. Avatar for cbwest 40. cbwest Lv 1 19 pts. 9,633

Comments