Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053
  1. Avatar for pfirth 81. pfirth Lv 1 2 pts. 8,760
  2. Avatar for benrh 82. benrh Lv 1 2 pts. 8,748
  3. Avatar for micheldeweerd 83. micheldeweerd Lv 1 1 pt. 8,732
  4. Avatar for RyeSnake 84. RyeSnake Lv 1 1 pt. 8,682
  5. Avatar for rezaefar 85. rezaefar Lv 1 1 pt. 8,668
  6. Avatar for Knoblerine 86. Knoblerine Lv 1 1 pt. 8,655
  7. Avatar for Kobata 87. Kobata Lv 1 1 pt. 8,643
  8. Avatar for Jesse Pinkman 88. Jesse Pinkman Lv 1 1 pt. 8,602
  9. Avatar for Vincera 89. Vincera Lv 1 1 pt. 8,588
  10. Avatar for fisherlr777 90. fisherlr777 Lv 1 1 pt. 8,531

Comments