Placeholder image of a protein
Icon representing a puzzle

1603: Unsolved De-novo Freestyle 138

Closed since over 7 years ago

Intermediate Overall Prediction

Summary

Created
November 27, 2018
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


MEGEVRGEKIKMGNVEGDAKEWKIKDLGVVGKGVFELNNTKVFIMVDESRQVGLAVFYDEDNNKMRAEVWVEIDHRRNAGVLNGRQVDIKDGHGRVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,408
  2. Avatar for Go Science 2. Go Science 70 pts. 10,310
  3. Avatar for Contenders 3. Contenders 47 pts. 10,257
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 10,236
  5. Avatar for Gargleblasters 5. Gargleblasters 19 pts. 10,142
  6. Avatar for Marvin's bunch 6. Marvin's bunch 11 pts. 10,002
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,968
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 9,942
  9. Avatar for Russian team 9. Russian team 2 pts. 9,704
  10. Avatar for SETI.Germany 10. SETI.Germany 1 pt. 9,053
  1. Avatar for aendgraend 71. aendgraend Lv 1 3 pts. 9,053
  2. Avatar for adelelopez 72. adelelopez Lv 1 3 pts. 8,919
  3. Avatar for ManVsYard 73. ManVsYard Lv 1 3 pts. 8,866
  4. Avatar for ViJay7019 74. ViJay7019 Lv 1 3 pts. 8,853
  5. Avatar for MakaAlbarn016 75. MakaAlbarn016 Lv 1 2 pts. 8,838
  6. Avatar for Altercomp 76. Altercomp Lv 1 2 pts. 8,828
  7. Avatar for DoctorSockrates 77. DoctorSockrates Lv 1 2 pts. 8,775
  8. Avatar for navn 78. navn Lv 1 2 pts. 8,774
  9. Avatar for rabamino12358 79. rabamino12358 Lv 1 2 pts. 8,772
  10. Avatar for kludbrook 80. kludbrook Lv 1 2 pts. 8,769

Comments