Placeholder image of a protein
Icon representing a puzzle

1621: Unsolved De-novo Freestyle 142

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 10, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

PAEEEIRTRIEILIRIAIERIKKLQLDETKIKILLTLLKIWIKIMLDIMTQIEDEKQIKTIITKIIIIILIILKQQS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,354
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 73 pts. 11,310
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 11,276
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 11,232
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 11,230
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 11,230
  7. Avatar for Contenders 7. Contenders 10 pts. 11,208
  8. Avatar for Gargleblasters 8. Gargleblasters 6 pts. 11,175
  9. Avatar for Hold My Beer 9. Hold My Beer 4 pts. 11,086
  10. Avatar for Russian team 10. Russian team 2 pts. 11,019
  1. Avatar for ShadowDuck2 111. ShadowDuck2 Lv 1 1 pt. 9,152
  2. Avatar for boondog 112. boondog Lv 1 1 pt. 9,146
  3. Avatar for mitarcher 113. mitarcher Lv 1 1 pt. 9,137
  4. Avatar for Sunmurder 114. Sunmurder Lv 1 1 pt. 9,124
  5. Avatar for ehhan2018 115. ehhan2018 Lv 1 1 pt. 8,958
  6. Avatar for kludbrook 116. kludbrook Lv 1 1 pt. 8,957
  7. Avatar for SouperGenious 117. SouperGenious Lv 1 1 pt. 8,824
  8. Avatar for vizhu2018 118. vizhu2018 Lv 1 1 pt. 8,772
  9. Avatar for jdmclure 119. jdmclure Lv 1 1 pt. 8,755
  10. Avatar for xbp 120. xbp Lv 1 1 pt. 8,582

Comments