Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for rolfpf 121. rolfpf Lv 1 1 pt. 6,393
  2. Avatar for Jasiok 122. Jasiok Lv 1 1 pt. 6,370
  3. Avatar for tomorrgg 123. tomorrgg Lv 1 1 pt. 6,019
  4. Avatar for NR22 124. NR22 Lv 1 1 pt. 5,962
  5. Avatar for KlausB 125. KlausB Lv 1 1 pt. 5,240
  6. Avatar for 01010011111 126. 01010011111 Lv 1 1 pt. 0
  7. Avatar for lamoille 127. lamoille Lv 1 1 pt. 0
  8. Avatar for Hollinas 128. Hollinas Lv 1 1 pt. 0
  9. Avatar for Susume 129. Susume Lv 1 1 pt. 0
  10. Avatar for lvanonse 130. lvanonse Lv 1 1 pt. 0

Comments