Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary


Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups


  1. Avatar for Beta Folders 100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097

  1. Avatar for Arne Heessels 61. Arne Heessels Lv 1 5 pts. 9,722
  2. Avatar for benrh 62. benrh Lv 1 5 pts. 9,714
  3. Avatar for cbwest 63. cbwest Lv 1 4 pts. 9,687
  4. Avatar for Mike Cassidy 64. Mike Cassidy Lv 1 4 pts. 9,662
  5. Avatar for Squirrely 65. Squirrely Lv 1 4 pts. 9,573
  6. Avatar for carsonfb 66. carsonfb Lv 1 4 pts. 9,556
  7. Avatar for Jesse Pinkman 67. Jesse Pinkman Lv 1 3 pts. 9,534
  8. Avatar for navn 68. navn Lv 1 3 pts. 9,508
  9. Avatar for fpc 69. fpc Lv 1 3 pts. 9,504
  10. Avatar for uihcv 70. uihcv Lv 1 3 pts. 9,500

Comments