Placeholder image of a protein
Icon representing a puzzle

1628: Unsolved De-novo Freestyle 144

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 24, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TEEEAKKALAEAKKHVEEARRQGKSAEAEKEAQKAEKKGERHARRGTTRKPEELARRGADEAREEGKRME

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,357
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,249
  3. Avatar for Go Science 3. Go Science 49 pts. 10,241
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,227
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 22 pts. 10,226
  6. Avatar for Hold My Beer 6. Hold My Beer 14 pts. 10,206
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,176
  8. Avatar for Contenders 8. Contenders 5 pts. 10,162
  9. Avatar for Void Crushers 9. Void Crushers 3 pts. 10,138
  10. Avatar for Russian team 10. Russian team 2 pts. 10,097
  1. Avatar for Phyx 31. Phyx Lv 1 27 pts. 9,984
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 26 pts. 9,982
  3. Avatar for phi16 33. phi16 Lv 1 25 pts. 9,979
  4. Avatar for TastyMunchies 34. TastyMunchies Lv 1 23 pts. 9,956
  5. Avatar for NinjaGreg 35. NinjaGreg Lv 1 22 pts. 9,933
  6. Avatar for andromeda72 36. andromeda72 Lv 1 21 pts. 9,926
  7. Avatar for jausmh 37. jausmh Lv 1 20 pts. 9,920
  8. Avatar for MicElephant 38. MicElephant Lv 1 19 pts. 9,904
  9. Avatar for Sissue 39. Sissue Lv 1 18 pts. 9,902
  10. Avatar for heather-1 40. heather-1 Lv 1 17 pts. 9,898

Comments