Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since about 7 years ago

Intermediate Overall Prediction

Summary

Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202
  1. Avatar for navn 71. navn Lv 1 7 pts. 9,492
  2. Avatar for Flagg65a 72. Flagg65a Lv 1 6 pts. 9,421
  3. Avatar for fpc 73. fpc Lv 1 6 pts. 9,408
  4. Avatar for petetrig 74. petetrig Lv 1 6 pts. 9,374
  5. Avatar for Vincera 75. Vincera Lv 1 5 pts. 9,364
  6. Avatar for O Seki To 76. O Seki To Lv 1 5 pts. 9,331
  7. Avatar for Jesse Pinkman 77. Jesse Pinkman Lv 1 5 pts. 9,331
  8. Avatar for pfirth 78. pfirth Lv 1 5 pts. 9,303
  9. Avatar for Artoria2e5 79. Artoria2e5 Lv 1 4 pts. 9,280
  10. Avatar for rabamino12358 80. rabamino12358 Lv 1 4 pts. 9,166

Comments