Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202

  1. Avatar for Arne Heessels 81. Arne Heessels Lv 1 4 pts. 9,093
  2. Avatar for hajtogato 82. hajtogato Lv 1 4 pts. 9,067
  3. Avatar for jamiexq 83. jamiexq Lv 1 4 pts. 9,066
  4. Avatar for lange 84. lange Lv 1 3 pts. 9,024
  5. Avatar for momadoc 85. momadoc Lv 1 3 pts. 9,007
  6. Avatar for harvardman 86. harvardman Lv 1 3 pts. 9,006
  7. Avatar for pandapharmd 87. pandapharmd Lv 1 3 pts. 8,994
  8. Avatar for carsonfb 88. carsonfb Lv 1 3 pts. 8,991
  9. Avatar for oureion 89. oureion Lv 1 3 pts. 8,967
  10. Avatar for boondog 90. boondog Lv 1 3 pts. 8,960

Comments