Placeholder image of a protein
Icon representing a puzzle

1631: Unsolved De-novo Freestyle 145

Closed since over 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
January 30, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

TIDDARKEIRWWARYYEKLLRMWKKIKGIEDELWKYFEKYLKEFWQWVLEAMKKFKYEEAEKRFREEFKLGEKWLREAVK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,617
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 10,538
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,516
  4. Avatar for Go Science 4. Go Science 36 pts. 10,457
  5. Avatar for Russian team 5. Russian team 24 pts. 10,381
  6. Avatar for Contenders 6. Contenders 16 pts. 10,365
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 10,323
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 10,304
  9. Avatar for Gargleblasters 9. Gargleblasters 4 pts. 10,231
  10. Avatar for Marvin's bunch 10. Marvin's bunch 2 pts. 10,202

  1. Avatar for Anfinsen_slept_here 51. Anfinsen_slept_here Lv 1 17 pts. 9,820
  2. Avatar for heather-1 52. heather-1 Lv 1 16 pts. 9,806
  3. Avatar for Crossed Sticks 53. Crossed Sticks Lv 1 15 pts. 9,793
  4. Avatar for Hellcat6 54. Hellcat6 Lv 1 15 pts. 9,793
  5. Avatar for Bletchley Park 55. Bletchley Park Lv 1 14 pts. 9,788
  6. Avatar for Squirrely 56. Squirrely Lv 1 13 pts. 9,781
  7. Avatar for @lison 57. @lison Lv 1 13 pts. 9,763
  8. Avatar for dbuske 58. dbuske Lv 1 12 pts. 9,763
  9. Avatar for aznarog 59. aznarog Lv 1 12 pts. 9,732
  10. Avatar for mitarcher 60. mitarcher Lv 1 11 pts. 9,696

Comments