Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697
  1. Avatar for ayyu 121. ayyu Lv 1 1 pt. 9,098
  2. Avatar for kerpowah 122. kerpowah Lv 1 1 pt. 9,017
  3. Avatar for lukas voltron 123. lukas voltron Lv 1 1 pt. 8,993
  4. Avatar for Tehnologik1 124. Tehnologik1 Lv 1 1 pt. 8,908
  5. Avatar for Deleted player 125. Deleted player pts. 8,870
  6. Avatar for DipsyDoodle2016 126. DipsyDoodle2016 Lv 1 1 pt. 8,700
  7. Avatar for 01010011111 127. 01010011111 Lv 1 1 pt. 8,568
  8. Avatar for Marc1028 128. Marc1028 Lv 1 1 pt. 8,165
  9. Avatar for dengziheng123 129. dengziheng123 Lv 1 1 pt. 8,165
  10. Avatar for Hollinas 130. Hollinas Lv 1 1 pt. 8,165

Comments