Placeholder image of a protein
Icon representing a puzzle

1660: Revisiting Puzzle 124: PDZ Domain

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 09, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of many proteins involved in cell signaling. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SMVPGKVTLQKDAQNLIGISIGGGAQPCLYIVQVFDNTPAALDGTVAAGDEITGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQYYKV

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,000
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 10,848
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 10,848
  4. Avatar for HMT heritage 4. HMT heritage 41 pts. 10,846
  5. Avatar for Go Science 5. Go Science 29 pts. 10,833
  6. Avatar for Contenders 6. Contenders 20 pts. 10,736
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 10,734
  8. Avatar for Russian team 8. Russian team 9 pts. 10,727
  9. Avatar for Void Crushers 9. Void Crushers 6 pts. 10,718
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,697

  1. Avatar for pfirth 91. pfirth Lv 1 1 pt. 9,725
  2. Avatar for dbuske 92. dbuske Lv 1 1 pt. 9,685
  3. Avatar for felixxy 93. felixxy Lv 1 1 pt. 9,661
  4. Avatar for f01d 94. f01d Lv 1 1 pt. 9,661
  5. Avatar for Arne Heessels 95. Arne Heessels Lv 1 1 pt. 9,632
  6. Avatar for John McLeod 96. John McLeod Lv 1 1 pt. 9,618
  7. Avatar for alwan2018 97. alwan2018 Lv 1 1 pt. 9,616
  8. Avatar for ehhan2018 98. ehhan2018 Lv 1 1 pt. 9,600
  9. Avatar for jamiexq 99. jamiexq Lv 1 1 pt. 9,600
  10. Avatar for rinze 100. rinze Lv 1 1 pt. 9,585

Comments