Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878
  1. Avatar for guineapig 31. guineapig Lv 1 30 pts. 9,819
  2. Avatar for phi16 32. phi16 Lv 1 29 pts. 9,795
  3. Avatar for georg137 33. georg137 Lv 1 27 pts. 9,784
  4. Avatar for Skippysk8s 34. Skippysk8s Lv 1 26 pts. 9,772
  5. Avatar for diamonddays 35. diamonddays Lv 1 25 pts. 9,703
  6. Avatar for hansvandenhof 36. hansvandenhof Lv 1 24 pts. 9,670
  7. Avatar for tarimo 37. tarimo Lv 1 23 pts. 9,598
  8. Avatar for Anfinsen_slept_here 38. Anfinsen_slept_here Lv 1 21 pts. 9,586
  9. Avatar for Flagg65a 39. Flagg65a Lv 1 20 pts. 9,584
  10. Avatar for Mike Cassidy 40. Mike Cassidy Lv 1 20 pts. 9,569

Comments