Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878
  1. Avatar for Arne Heessels 91. Arne Heessels Lv 1 1 pt. 7,878
  2. Avatar for jeremiasivan 92. jeremiasivan Lv 1 1 pt. 7,862
  3. Avatar for MrZanav 93. MrZanav Lv 1 1 pt. 7,770
  4. Avatar for hajtogato 94. hajtogato Lv 1 1 pt. 7,768
  5. Avatar for frostschutz 95. frostschutz Lv 1 1 pt. 7,741
  6. Avatar for Zainul0103 96. Zainul0103 Lv 1 1 pt. 7,676
  7. Avatar for Bautho 97. Bautho Lv 1 1 pt. 7,567
  8. Avatar for BrandonL 98. BrandonL Lv 1 1 pt. 7,464
  9. Avatar for Museka 99. Museka Lv 1 1 pt. 7,412
  10. Avatar for carsonfb 100. carsonfb Lv 1 1 pt. 7,367

Comments