Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878
  1. Avatar for TastyMunchies 51. TastyMunchies Lv 1 11 pts. 9,317
  2. Avatar for aznarog 52. aznarog Lv 1 10 pts. 9,302
  3. Avatar for benrh 53. benrh Lv 1 10 pts. 9,294
  4. Avatar for MicElephant 54. MicElephant Lv 1 9 pts. 9,267
  5. Avatar for dcrwheeler 55. dcrwheeler Lv 1 9 pts. 9,264
  6. Avatar for timroberts16 56. timroberts16 Lv 1 8 pts. 9,261
  7. Avatar for Cagdason 57. Cagdason Lv 1 8 pts. 9,238
  8. Avatar for abiogenesis 58. abiogenesis Lv 1 7 pts. 9,238
  9. Avatar for Maerlyn138 59. Maerlyn138 Lv 1 7 pts. 9,215
  10. Avatar for Sissue 60. Sissue Lv 1 7 pts. 9,210

Comments