Placeholder image of a protein
Icon representing a puzzle

1661: Unsolved De-novo Freestyle 151

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
April 12, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

IVIVVVIITDDESQRKEVKERTKETIKKHPHVMYVVFVIIEIVIRLGGMVIVYVTDDEDVIRKVIKTHQSKGTIVVVIYE

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,555
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,247
  3. Avatar for Marvin's bunch 3. Marvin's bunch 58 pts. 10,199
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 10,093
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,089
  6. Avatar for Go Science 6. Go Science 22 pts. 9,950
  7. Avatar for Hold My Beer 7. Hold My Beer 15 pts. 9,946
  8. Avatar for Russian team 8. Russian team 11 pts. 9,923
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,895
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,878

  1. Avatar for alcor29 81. alcor29 Lv 1 2 pts. 8,257
  2. Avatar for monteecristo 82. monteecristo Lv 1 2 pts. 8,219
  3. Avatar for RyeSnake 83. RyeSnake Lv 1 2 pts. 8,178
  4. Avatar for toshiue 84. toshiue Lv 1 2 pts. 8,175
  5. Avatar for Silvercraft 85. Silvercraft Lv 1 1 pt. 8,122
  6. Avatar for oureion 86. oureion Lv 1 1 pt. 8,072
  7. Avatar for Lyshi2018 87. Lyshi2018 Lv 1 1 pt. 8,015
  8. Avatar for GUANINJIN 88. GUANINJIN Lv 1 1 pt. 7,937
  9. Avatar for dbuske 89. dbuske Lv 1 1 pt. 7,921
  10. Avatar for borattt 90. borattt Lv 1 1 pt. 7,897

Comments