Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052
  1. Avatar for alwen 61. alwen Lv 1 7 pts. 9,867
  2. Avatar for Vinara 62. Vinara Lv 1 6 pts. 9,865
  3. Avatar for ManVsYard 63. ManVsYard Lv 1 6 pts. 9,847
  4. Avatar for Deleted player 64. Deleted player pts. 9,840
  5. Avatar for Maerlyn138 65. Maerlyn138 Lv 1 5 pts. 9,840
  6. Avatar for Altercomp 66. Altercomp Lv 1 5 pts. 9,835
  7. Avatar for JasperD 67. JasperD Lv 1 5 pts. 9,823
  8. Avatar for benrh 68. benrh Lv 1 4 pts. 9,812
  9. Avatar for Lyshi2018 69. Lyshi2018 Lv 1 4 pts. 9,811
  10. Avatar for Alistair69 70. Alistair69 Lv 1 4 pts. 9,782

Comments