Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052
  1. Avatar for phi16 51. phi16 Lv 1 12 pts. 9,959
  2. Avatar for fpc 52. fpc Lv 1 11 pts. 9,943
  3. Avatar for guineapig 53. guineapig Lv 1 11 pts. 9,941
  4. Avatar for Aminal88 54. Aminal88 Lv 1 10 pts. 9,937
  5. Avatar for Cagdason 55. Cagdason Lv 1 9 pts. 9,932
  6. Avatar for hansvandenhof 56. hansvandenhof Lv 1 9 pts. 9,931
  7. Avatar for diamonddays 57. diamonddays Lv 1 8 pts. 9,921
  8. Avatar for tarimo 58. tarimo Lv 1 8 pts. 9,892
  9. Avatar for DodoBird 59. DodoBird Lv 1 8 pts. 9,882
  10. Avatar for timroberts16 60. timroberts16 Lv 1 7 pts. 9,868

Comments