Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052

  1. Avatar for Flagg65a 21. Flagg65a Lv 1 47 pts. 10,082
  2. Avatar for vakobo 22. vakobo Lv 1 45 pts. 10,076
  3. Avatar for georg137 23. georg137 Lv 1 43 pts. 10,075
  4. Avatar for reefyrob 24. reefyrob Lv 1 42 pts. 10,069
  5. Avatar for NinjaGreg 25. NinjaGreg Lv 1 40 pts. 10,066
  6. Avatar for silent gene 26. silent gene Lv 1 38 pts. 10,060
  7. Avatar for Blipperman 27. Blipperman Lv 1 37 pts. 10,058
  8. Avatar for Tehnologik1 28. Tehnologik1 Lv 1 35 pts. 10,055
  9. Avatar for Sissue 29. Sissue Lv 1 34 pts. 10,055
  10. Avatar for carsonfb 30. carsonfb Lv 1 32 pts. 10,054

Comments