Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Beta Folders 100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052

  1. Avatar for Idiotboy 41. Idiotboy Lv 1 19 pts. 10,005
  2. Avatar for Museka 42. Museka Lv 1 18 pts. 9,998
  3. Avatar for YeshuaLives 43. YeshuaLives Lv 1 18 pts. 9,996
  4. Avatar for cobaltteal 44. cobaltteal Lv 1 17 pts. 9,992
  5. Avatar for alcor29 45. alcor29 Lv 1 16 pts. 9,988
  6. Avatar for Bletchley Park 46. Bletchley Park Lv 1 15 pts. 9,987
  7. Avatar for stomjoh 47. stomjoh Lv 1 14 pts. 9,976
  8. Avatar for jausmh 48. jausmh Lv 1 14 pts. 9,975
  9. Avatar for cbwest 49. cbwest Lv 1 13 pts. 9,974
  10. Avatar for rezaefar 50. rezaefar Lv 1 12 pts. 9,963

Comments