Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,893
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,851
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,843
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,789
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,755
  6. Avatar for Contenders 6. Contenders 22 pts. 10,736
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,694
  8. Avatar for Russian team 8. Russian team 11 pts. 10,692
  9. Avatar for The Daydreamers 9. The Daydreamers 7 pts. 10,515
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 10,465
  1. Avatar for Phyx 21. Phyx Lv 1 40 pts. 10,622
  2. Avatar for TastyMunchies 22. TastyMunchies Lv 1 38 pts. 10,607
  3. Avatar for mberna00 23. mberna00 Lv 1 36 pts. 10,600
  4. Avatar for jobo0502 24. jobo0502 Lv 1 34 pts. 10,599
  5. Avatar for nicobul 25. nicobul Lv 1 32 pts. 10,597
  6. Avatar for robgee 26. robgee Lv 1 31 pts. 10,577
  7. Avatar for Merf 27. Merf Lv 1 29 pts. 10,572
  8. Avatar for guineapig 28. guineapig Lv 1 27 pts. 10,556
  9. Avatar for phi16 29. phi16 Lv 1 26 pts. 10,515
  10. Avatar for Cloudy101 30. Cloudy101 Lv 1 25 pts. 10,515

Comments