Placeholder image of a protein
Icon representing a puzzle

1765: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
November 26, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,819
  2. Avatar for Go Science 2. Go Science 74 pts. 10,782
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,721
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,606
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,557
  6. Avatar for HMT heritage 6. HMT heritage 18 pts. 10,514
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 10,446
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 10,420
  9. Avatar for Contenders 9. Contenders 5 pts. 10,380
  10. Avatar for Russian team 10. Russian team 3 pts. 10,376
  1. Avatar for Hellcat6 71. Hellcat6 Lv 1 3 pts. 9,948
  2. Avatar for heather-1 72. heather-1 Lv 1 3 pts. 9,929
  3. Avatar for knotartist 73. knotartist Lv 1 2 pts. 9,921
  4. Avatar for rabamino12358 74. rabamino12358 Lv 1 2 pts. 9,898
  5. Avatar for RootBeerSwordsman 75. RootBeerSwordsman Lv 1 2 pts. 9,897
  6. Avatar for Vincera 76. Vincera Lv 1 2 pts. 9,897
  7. Avatar for rinze 77. rinze Lv 1 2 pts. 9,866
  8. Avatar for Steven Pletsch 78. Steven Pletsch Lv 1 2 pts. 9,864
  9. Avatar for pielie 79. pielie Lv 1 2 pts. 9,849
  10. Avatar for xbp 80. xbp Lv 1 2 pts. 9,839

Comments