Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for jobo0502 11. jobo0502 Lv 1 74 pts. 11,186
  2. Avatar for guineapig 12. guineapig Lv 1 71 pts. 11,159
  3. Avatar for Xartos 13. Xartos Lv 1 69 pts. 11,141
  4. Avatar for NinjaGreg 14. NinjaGreg Lv 1 67 pts. 11,137
  5. Avatar for Deleted player 15. Deleted player pts. 11,101
  6. Avatar for pauldunn 16. pauldunn Lv 1 63 pts. 11,096
  7. Avatar for grogar7 17. grogar7 Lv 1 61 pts. 11,095
  8. Avatar for ichwilldiesennamen 18. ichwilldiesennamen Lv 1 59 pts. 11,075
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 57 pts. 11,066
  10. Avatar for jausmh 20. jausmh Lv 1 55 pts. 11,023

Comments