Placeholder image of a protein
Icon representing a puzzle

1869: Refinement Puzzle: R1049

Closed since over 5 years ago

Novice Overall Prediction

Summary

Created
July 24, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=51. This means that about half of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


SIFSYITESTGTPSNATYTYVIERWDPETSGILNPCYGWPVCYVTVNHKHTVNGTGGNPAFQIARIEKLRTLAEVRDVVLKNRSFPIEGQTTHRGPSLNSNQECVGLFYQPNSSGISPRGKLLPGSLCGIAPPP

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 11,477
  2. Avatar for Go Science 2. Go Science 77 pts. 11,393
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 58 pts. 11,303
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 11,186
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 11,132
  6. Avatar for Contenders 6. Contenders 22 pts. 11,066
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 10,994
  8. Avatar for Hold My Beer 8. Hold My Beer 11 pts. 10,994
  9. Avatar for Gargleblasters 9. Gargleblasters 7 pts. 10,969
  10. Avatar for Russian team 10. Russian team 5 pts. 10,323
  1. Avatar for aznarog 41. aznarog Lv 1 26 pts. 10,662
  2. Avatar for dcrwheeler 42. dcrwheeler Lv 1 25 pts. 10,656
  3. Avatar for OWM3 43. OWM3 Lv 1 24 pts. 10,625
  4. Avatar for John McLeod 44. John McLeod Lv 1 23 pts. 10,601
  5. Avatar for fpc 45. fpc Lv 1 22 pts. 10,593
  6. Avatar for Blipperman 46. Blipperman Lv 1 21 pts. 10,585
  7. Avatar for MrZanav 47. MrZanav Lv 1 20 pts. 10,484
  8. Avatar for Alistair69 48. Alistair69 Lv 1 19 pts. 10,467
  9. Avatar for andrewxc 49. andrewxc Lv 1 19 pts. 10,438
  10. Avatar for RockOn 50. RockOn Lv 1 18 pts. 10,431

Comments