Placeholder image of a protein
Icon representing a puzzle

1878: Refinement Puzzle: R1034

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 13, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with starting model's GDT_HA=70. This means that about 70% of the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


LILNLRGGAFVSNTQITMADKQKKFINEIQEGDLVRSYSITDETFQQNAVTSIVKHEADQLCQINFGKQHVVCTVNHRFYDPESKLWKSVCPHPGSGISFLKKYDYLLSEEGEKLQITEIKTFTTKQPVFIYHIQVENNHNFFANGVLAHAMQVSI

Top groups


  1. Avatar for Go Science 100 pts. 12,516
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 12,501
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 12,383
  4. Avatar for Hold My Beer 4. Hold My Beer 33 pts. 12,326
  5. Avatar for Gargleblasters 5. Gargleblasters 22 pts. 12,310
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 14 pts. 12,268
  7. Avatar for Contenders 7. Contenders 8 pts. 12,255
  8. Avatar for Void Crushers 8. Void Crushers 5 pts. 12,064
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 11,819
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 11,403

  1. Avatar for borattt 101. borattt Lv 1 1 pt. 10,817
  2. Avatar for jsfoldingaccount 102. jsfoldingaccount Lv 1 1 pt. 10,785
  3. Avatar for jamiexq 103. jamiexq Lv 1 1 pt. 10,764
  4. Avatar for Dr.Sillem 104. Dr.Sillem Lv 1 1 pt. 10,755
  5. Avatar for skovz99 105. skovz99 Lv 1 1 pt. 10,752
  6. Avatar for manu8170 106. manu8170 Lv 1 1 pt. 10,745
  7. Avatar for davidoskky 107. davidoskky Lv 1 1 pt. 10,736
  8. Avatar for ivalnic 108. ivalnic Lv 1 1 pt. 10,731
  9. Avatar for Bearpaw 109. Bearpaw Lv 1 1 pt. 10,720
  10. Avatar for Rodrigo Rato 110. Rodrigo Rato Lv 1 1 pt. 10,709

Comments