Placeholder image of a protein
Icon representing a puzzle

1884: Refinement Target: R1056

Closed since almost 6 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
August 28, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target without any accuracy estimates, so we're unsure how well the starting structure matches the native structure. Look for better scoring folds to find the true native structure!



Sequence:


MLTAIDYLTKKGWKISSDPRTYDGYPKNYGYRNYHENGINYDEFCGGYHRAFDVYSNETNDVPAVTSGTVIEANDYGNFGGTFVIRDANDNDWIYGHLQRGSMRFVVGDKVNQGDIIGLQGNSNYYDNPMSVHLHLQLRPKDAKKDEKSQVCSGLAMEKYDITNLNAKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 12,653
  2. Avatar for Hold My Beer 2. Hold My Beer 73 pts. 12,606
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 12,559
  4. Avatar for Go Science 4. Go Science 36 pts. 12,465
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 12,412
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 12,270
  7. Avatar for Contenders 7. Contenders 10 pts. 12,203
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 12,115
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 11,961
  10. Avatar for SETI.Germany 10. SETI.Germany 2 pts. 10,805

  1. Avatar for mrmookie 91. mrmookie Lv 1 2 pts. 9,999
  2. Avatar for CAN1958 92. CAN1958 Lv 1 2 pts. 9,995
  3. Avatar for fearjuan 93. fearjuan Lv 1 2 pts. 9,928
  4. Avatar for Deleted player 94. Deleted player pts. 9,903
  5. Avatar for kludbrook 95. kludbrook Lv 1 2 pts. 9,897
  6. Avatar for JasperD 96. JasperD Lv 1 1 pt. 9,876
  7. Avatar for hada 97. hada Lv 1 1 pt. 9,862
  8. Avatar for rinze 98. rinze Lv 1 1 pt. 9,860
  9. Avatar for Raguth Wolf 99. Raguth Wolf Lv 1 1 pt. 9,839
  10. Avatar for rabamino12358 100. rabamino12358 Lv 1 1 pt. 9,835

Comments