Placeholder image of a protein
Icon representing a puzzle

2016: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 08, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,957
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 10,950
  3. Avatar for Go Science 3. Go Science 47 pts. 10,945
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 30 pts. 10,724
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 10,715
  6. Avatar for Gargleblasters 6. Gargleblasters 11 pts. 10,601
  7. Avatar for Void Crushers 7. Void Crushers 7 pts. 10,520
  8. Avatar for Contenders 8. Contenders 4 pts. 10,419
  9. Avatar for Australia 9. Australia 2 pts. 10,325
  10. Avatar for Team China 10. Team China 1 pt. 10,176
  1. Avatar for equilibria 61. equilibria Lv 1 5 pts. 10,217
  2. Avatar for BarrySampson 62. BarrySampson Lv 1 4 pts. 10,187
  3. Avatar for rezaefar 63. rezaefar Lv 1 4 pts. 10,184
  4. Avatar for pfirth 64. pfirth Lv 1 4 pts. 10,180
  5. Avatar for zo3xiaJonWeinberg 65. zo3xiaJonWeinberg Lv 1 4 pts. 10,176
  6. Avatar for kevin everington 66. kevin everington Lv 1 3 pts. 10,176
  7. Avatar for abiogenesis 67. abiogenesis Lv 1 3 pts. 10,169
  8. Avatar for Trajan464 68. Trajan464 Lv 1 3 pts. 10,164
  9. Avatar for Matroch 69. Matroch Lv 1 3 pts. 10,163
  10. Avatar for AlkiP0Ps 70. AlkiP0Ps Lv 1 3 pts. 10,148

Comments