Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,292
  2. Avatar for Go Science 2. Go Science 65 pts. 11,219
  3. Avatar for Beta Folders 3. Beta Folders 41 pts. 11,208
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,166
  5. Avatar for Contenders 5. Contenders 14 pts. 11,144
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,932
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,811
  8. Avatar for Australia 8. Australia 2 pts. 10,751
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,697
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,654
  1. Avatar for Todd6485577 31. Todd6485577 Lv 1 27 pts. 10,791
  2. Avatar for MicElephant 32. MicElephant Lv 1 25 pts. 10,788
  3. Avatar for WBarme1234 33. WBarme1234 Lv 1 24 pts. 10,781
  4. Avatar for nicobul 34. nicobul Lv 1 23 pts. 10,780
  5. Avatar for hada 35. hada Lv 1 22 pts. 10,774
  6. Avatar for jobo0502 36. jobo0502 Lv 1 21 pts. 10,765
  7. Avatar for kyoota 37. kyoota Lv 1 20 pts. 10,751
  8. Avatar for ZeroLeak7 38. ZeroLeak7 Lv 1 19 pts. 10,705
  9. Avatar for ShadowTactics 39. ShadowTactics Lv 1 18 pts. 10,697
  10. Avatar for zackallen 40. zackallen Lv 1 17 pts. 10,695

Comments