Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,292
  2. Avatar for Go Science 2. Go Science 65 pts. 11,219
  3. Avatar for Beta Folders 3. Beta Folders 41 pts. 11,208
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,166
  5. Avatar for Contenders 5. Contenders 14 pts. 11,144
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,932
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,811
  8. Avatar for Australia 8. Australia 2 pts. 10,751
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,697
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,654
  1. Avatar for Deleted player 21. Deleted player pts. 10,983
  2. Avatar for alcor29 22. alcor29 Lv 1 41 pts. 10,979
  3. Avatar for Skippysk8s 23. Skippysk8s Lv 1 39 pts. 10,932
  4. Avatar for ProfVince 24. ProfVince Lv 1 38 pts. 10,923
  5. Avatar for rezaefar 25. rezaefar Lv 1 36 pts. 10,905
  6. Avatar for Blipperman 26. Blipperman Lv 1 34 pts. 10,880
  7. Avatar for OWM3 27. OWM3 Lv 1 33 pts. 10,874
  8. Avatar for stomjoh 28. stomjoh Lv 1 31 pts. 10,872
  9. Avatar for christioanchauvin 29. christioanchauvin Lv 1 30 pts. 10,811
  10. Avatar for akaaka 30. akaaka Lv 1 28 pts. 10,795

Comments