Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,292
  2. Avatar for Go Science 2. Go Science 65 pts. 11,219
  3. Avatar for Beta Folders 3. Beta Folders 41 pts. 11,208
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,166
  5. Avatar for Contenders 5. Contenders 14 pts. 11,144
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,932
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,811
  8. Avatar for Australia 8. Australia 2 pts. 10,751
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,697
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,654
  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 67 pts. 11,144
  2. Avatar for frood66 12. frood66 Lv 1 64 pts. 11,123
  3. Avatar for mirp 13. mirp Lv 1 62 pts. 11,120
  4. Avatar for g_b 14. g_b Lv 1 59 pts. 11,101
  5. Avatar for NPrincipi 15. NPrincipi Lv 1 57 pts. 11,086
  6. Avatar for Maerlyn138 16. Maerlyn138 Lv 1 54 pts. 11,025
  7. Avatar for Lotus23 17. Lotus23 Lv 1 52 pts. 11,016
  8. Avatar for guineapig 18. guineapig Lv 1 50 pts. 11,002
  9. Avatar for fiendish_ghoul 19. fiendish_ghoul Lv 1 47 pts. 11,000
  10. Avatar for robgee 20. robgee Lv 1 45 pts. 10,996

Comments