Placeholder image of a protein
Icon representing a puzzle

2019: Revisiting Puzzle 71: Crystallin

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
July 15, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 11,292
  2. Avatar for Go Science 2. Go Science 65 pts. 11,219
  3. Avatar for Beta Folders 3. Beta Folders 41 pts. 11,208
  4. Avatar for Marvin's bunch 4. Marvin's bunch 24 pts. 11,166
  5. Avatar for Contenders 5. Contenders 14 pts. 11,144
  6. Avatar for Gargleblasters 6. Gargleblasters 7 pts. 10,932
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 4 pts. 10,811
  8. Avatar for Australia 8. Australia 2 pts. 10,751
  9. Avatar for BOINC@Poland 9. BOINC@Poland 1 pt. 10,697
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 10,654
  1. Avatar for infjamc 51. infjamc Lv 1 9 pts. 10,567
  2. Avatar for fearjuan 52. fearjuan Lv 1 8 pts. 10,525
  3. Avatar for tracybutt 53. tracybutt Lv 1 8 pts. 10,495
  4. Avatar for Simek 54. Simek Lv 1 7 pts. 10,488
  5. Avatar for manu8170 55. manu8170 Lv 1 7 pts. 10,477
  6. Avatar for dahast.de 56. dahast.de Lv 1 7 pts. 10,454
  7. Avatar for toshiue 57. toshiue Lv 1 6 pts. 10,448
  8. Avatar for jausmh 58. jausmh Lv 1 6 pts. 10,446
  9. Avatar for blazegeek 59. blazegeek Lv 1 5 pts. 10,427
  10. Avatar for silent gene 60. silent gene Lv 1 5 pts. 10,413

Comments