Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for Kai_L 131. Kai_L Lv 1 1 pt. 8,630
  2. Avatar for pascal ochem 132. pascal ochem Lv 1 1 pt. 8,562
  3. Avatar for Emrys89 133. Emrys89 Lv 1 1 pt. 8,347
  4. Avatar for Deleted player 134. Deleted player 1 pt. 8,010
  5. Avatar for jm4549 135. jm4549 Lv 1 1 pt. 6,503
  6. Avatar for mvrlin 136. mvrlin Lv 1 1 pt. 2,986
  7. Avatar for joshmiller 137. joshmiller Lv 1 1 pt. 0
  8. Avatar for bkoep 138. bkoep Lv 1 1 pt. 0
  9. Avatar for joshtest01 139. joshtest01 Lv 1 1 pt. 0
  10. Avatar for Gabrysaid 140. Gabrysaid Lv 1 1 pt. 0

Comments