Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for Ragstten 111. Ragstten Lv 1 1 pt. 9,256
  2. Avatar for Cicadashell 112. Cicadashell Lv 1 1 pt. 9,251
  3. Avatar for jamestpierce 113. jamestpierce Lv 1 1 pt. 9,238
  4. Avatar for fsakaikawada 114. fsakaikawada Lv 1 1 pt. 9,224
  5. Avatar for davidandersoniii 115. davidandersoniii Lv 1 1 pt. 9,202
  6. Avatar for Franky0045 116. Franky0045 Lv 1 1 pt. 9,183
  7. Avatar for Swapper242 117. Swapper242 Lv 1 1 pt. 9,172
  8. Avatar for zhanghch 118. zhanghch Lv 1 1 pt. 9,172
  9. Avatar for furi0us 119. furi0us Lv 1 1 pt. 9,169
  10. Avatar for brucederby 120. brucederby Lv 1 1 pt. 9,136

Comments