Placeholder image of a protein
Icon representing a puzzle

2030: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 4 years ago

Novice Overall Prediction

Summary

Created
August 12, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,195
  2. Avatar for Go Science 2. Go Science 73 pts. 10,174
  3. Avatar for Beta Folders 3. Beta Folders 52 pts. 10,153
  4. Avatar for Contenders 4. Contenders 36 pts. 10,135
  5. Avatar for Marvin's bunch 5. Marvin's bunch 24 pts. 10,076
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 10,069
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,971
  8. Avatar for Russian team 8. Russian team 6 pts. 9,906
  9. Avatar for Australia 9. Australia 4 pts. 9,866
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,701
  1. Avatar for Gematron 2874 101. Gematron 2874 Lv 1 1 pt. 9,333
  2. Avatar for Mohoernchen 102. Mohoernchen Lv 1 1 pt. 9,332
  3. Avatar for jjquan 103. jjquan Lv 1 1 pt. 9,325
  4. Avatar for kevin everington 104. kevin everington Lv 1 1 pt. 9,322
  5. Avatar for harvardman 105. harvardman Lv 1 1 pt. 9,313
  6. Avatar for 123rrc 106. 123rrc Lv 1 1 pt. 9,292
  7. Avatar for Sammy3c2b1a0 107. Sammy3c2b1a0 Lv 1 1 pt. 9,291
  8. Avatar for bluelybell 108. bluelybell Lv 1 1 pt. 9,291
  9. Avatar for Licot 109. Licot Lv 1 1 pt. 9,287
  10. Avatar for sabrina23 110. sabrina23 Lv 1 1 pt. 9,260

Comments