Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241
  1. Avatar for robgee 11. robgee Lv 1 72 pts. 10,029
  2. Avatar for Deleted player 12. Deleted player pts. 10,014
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 67 pts. 10,006
  4. Avatar for MicElephant 14. MicElephant Lv 1 65 pts. 10,000
  5. Avatar for Bruno Kestemont 15. Bruno Kestemont Lv 1 63 pts. 9,989
  6. Avatar for guineapig 16. guineapig Lv 1 60 pts. 9,964
  7. Avatar for silent gene 17. silent gene Lv 1 58 pts. 9,953
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 56 pts. 9,946
  9. Avatar for Punzi Baker 2 19. Punzi Baker 2 Lv 1 54 pts. 9,929
  10. Avatar for g_b 20. g_b Lv 1 52 pts. 9,903

Comments