Placeholder image of a protein
Icon representing a puzzle

2089: Revisiting Puzzle 96: Collagen

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
December 30, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:

TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,285
  2. Avatar for Marvin's bunch 2. Marvin's bunch 74 pts. 10,162
  3. Avatar for Gargleblasters 3. Gargleblasters 54 pts. 10,132
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 38 pts. 10,120
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 27 pts. 10,052
  6. Avatar for Go Science 6. Go Science 18 pts. 10,037
  7. Avatar for Contenders 7. Contenders 12 pts. 9,946
  8. Avatar for FoldIt@Netherlands 8. FoldIt@Netherlands 8 pts. 9,689
  9. Avatar for Void Crushers 9. Void Crushers 5 pts. 9,273
  10. Avatar for Russian team 10. Russian team 3 pts. 9,241
  1. Avatar for fishercat 51. fishercat Lv 1 15 pts. 9,139
  2. Avatar for carxo 52. carxo Lv 1 14 pts. 9,109
  3. Avatar for borattt 53. borattt Lv 1 13 pts. 9,099
  4. Avatar for cherry39 54. cherry39 Lv 1 13 pts. 9,097
  5. Avatar for antibot215 55. antibot215 Lv 1 12 pts. 9,010
  6. Avatar for Vincera 56. Vincera Lv 1 11 pts. 9,006
  7. Avatar for Wiz kid 57. Wiz kid Lv 1 11 pts. 8,990
  8. Avatar for tracybutt 58. tracybutt Lv 1 10 pts. 8,988
  9. Avatar for bamh 59. bamh Lv 1 10 pts. 8,979
  10. Avatar for deus911 60. deus911 Lv 1 9 pts. 8,967

Comments