Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for huangbinapple 151. huangbinapple Lv 1 1 pt. 5,306
  2. Avatar for Atryx 152. Atryx Lv 1 1 pt. 5,303
  3. Avatar for mariandd33 153. mariandd33 Lv 1 1 pt. 5,302
  4. Avatar for vishakhaanbhore 154. vishakhaanbhore Lv 1 1 pt. 5,295
  5. Avatar for kw2018 155. kw2018 Lv 1 1 pt. 5,287
  6. Avatar for bbgirl664 156. bbgirl664 Lv 1 1 pt. 5,253
  7. Avatar for ballix22 157. ballix22 Lv 1 1 pt. 5,214
  8. Avatar for SACfer85 158. SACfer85 Lv 1 1 pt. 5,132
  9. Avatar for Jeriel Goicochea 159. Jeriel Goicochea Lv 1 1 pt. 5,123
  10. Avatar for gunnermens 160. gunnermens Lv 1 1 pt. 5,122

Comments