Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570
  1. Avatar for leandrotiburske 131. leandrotiburske Lv 1 1 pt. 7,648
  2. Avatar for nstagnitti 132. nstagnitti Lv 1 1 pt. 7,641
  3. Avatar for lorenzo010 133. lorenzo010 Lv 1 1 pt. 7,635
  4. Avatar for anajus2021 134. anajus2021 Lv 1 1 pt. 7,624
  5. Avatar for Dodo97 135. Dodo97 Lv 1 1 pt. 7,617
  6. Avatar for harvardman 136. harvardman Lv 1 1 pt. 7,510
  7. Avatar for Sakai Izumi 137. Sakai Izumi Lv 1 1 pt. 7,488
  8. Avatar for frood66 138. frood66 Lv 1 1 pt. 7,432
  9. Avatar for acemab 139. acemab Lv 1 1 pt. 7,417
  10. Avatar for banacorn 140. banacorn Lv 1 1 pt. 7,396

Comments