Placeholder image of a protein
Icon representing a puzzle

2098: Revisiting Puzzle 110: Turkey

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
January 20, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups


  1. Avatar for Go Science 100 pts. 10,599
  2. Avatar for Contenders 2. Contenders 71 pts. 10,473
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 10,464
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 10,450
  5. Avatar for Void Crushers 5. Void Crushers 22 pts. 10,384
  6. Avatar for Marvin's bunch 6. Marvin's bunch 14 pts. 10,312
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 10,287
  8. Avatar for Gargleblasters 8. Gargleblasters 5 pts. 10,244
  9. Avatar for Australia 9. Australia 3 pts. 9,702
  10. Avatar for Russian team 10. Russian team 2 pts. 9,570

  1. Avatar for Arne Heessels 61. Arne Heessels Lv 1 13 pts. 9,676
  2. Avatar for frostschutz 62. frostschutz Lv 1 13 pts. 9,657
  3. Avatar for equilibria 63. equilibria Lv 1 12 pts. 9,637
  4. Avatar for Wiz kid 64. Wiz kid Lv 1 12 pts. 9,596
  5. Avatar for ComputerMage 65. ComputerMage Lv 1 11 pts. 9,570
  6. Avatar for ucad 66. ucad Lv 1 11 pts. 9,492
  7. Avatar for timegrinder 67. timegrinder Lv 1 10 pts. 9,482
  8. Avatar for Trajan464 68. Trajan464 Lv 1 10 pts. 9,433
  9. Avatar for NeLikomSheet 69. NeLikomSheet Lv 1 9 pts. 9,425
  10. Avatar for ShadowTactics 70. ShadowTactics Lv 1 9 pts. 9,410

Comments