Placeholder image of a protein
Icon representing a puzzle

2110: Revisiting Puzzle 114: Black Mamba

Closed since about 4 years ago

Novice Overall Prediction

Summary

Created
February 17, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Marvin's bunch
    1. Marvin's bunch
    100 pts. 11,278
  2. Avatar for Go Science 2. Go Science 74 pts. 11,269
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 11,233
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 11,219
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 11,029
  6. Avatar for Contenders 6. Contenders 18 pts. 11,018
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 11,013
  8. Avatar for Australia 8. Australia 8 pts. 10,255
  9. Avatar for Foldit Staff 9. Foldit Staff 5 pts. 9,515
  10. Avatar for BIOF215 10. BIOF215 3 pts. 9,452
  1. Avatar for Hebrew Hitman 81. Hebrew Hitman Lv 1 5 pts. 9,330
  2. Avatar for pruneau_44 82. pruneau_44 Lv 1 5 pts. 9,319
  3. Avatar for LELE1964 83. LELE1964 Lv 1 5 pts. 9,310
  4. Avatar for anirudha_t 84. anirudha_t Lv 1 4 pts. 9,308
  5. Avatar for Swapper242 85. Swapper242 Lv 1 4 pts. 9,289
  6. Avatar for protonoah 86. protonoah Lv 1 4 pts. 9,286
  7. Avatar for gen1us29 87. gen1us29 Lv 1 4 pts. 9,283
  8. Avatar for kreichel 88. kreichel Lv 1 4 pts. 9,276
  9. Avatar for pratham 89. pratham Lv 1 3 pts. 9,264
  10. Avatar for hjl2022 90. hjl2022 Lv 1 3 pts. 9,263

Comments