Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 21,038
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 21,032
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 20,854
  4. Avatar for Contenders 4. Contenders 36 pts. 20,854
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 20,809
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,754
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 20,658
  8. Avatar for VeFold 8. VeFold 6 pts. 20,457
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 20,451
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 20,426
  1. Avatar for gmn 11. gmn Lv 1 52 pts. 20,940
  2. Avatar for grogar7 12. grogar7 Lv 1 49 pts. 20,855
  3. Avatar for MicElephant 13. MicElephant Lv 1 45 pts. 20,854
  4. Avatar for Bletchley Park 14. Bletchley Park Lv 1 42 pts. 20,852
  5. Avatar for Timo van der Laan 15. Timo van der Laan Lv 1 39 pts. 20,809
  6. Avatar for spmm 16. spmm Lv 1 36 pts. 20,793
  7. Avatar for Idiotboy 17. Idiotboy Lv 1 34 pts. 20,764
  8. Avatar for Steven Pletsch 18. Steven Pletsch Lv 1 31 pts. 20,754
  9. Avatar for guineapig 19. guineapig Lv 1 29 pts. 20,751
  10. Avatar for maithra 20. maithra Lv 1 27 pts. 20,692

Comments