Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 21,038
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 21,032
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 20,854
  4. Avatar for Contenders 4. Contenders 36 pts. 20,854
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 20,809
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,754
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 20,658
  8. Avatar for VeFold 8. VeFold 6 pts. 20,457
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 20,451
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 20,426
  1. Avatar for bamh 21. bamh Lv 1 25 pts. 20,677
  2. Avatar for equilibria 22. equilibria Lv 1 23 pts. 20,670
  3. Avatar for christioanchauvin 23. christioanchauvin Lv 1 21 pts. 20,658
  4. Avatar for NPrincipi 24. NPrincipi Lv 1 19 pts. 20,652
  5. Avatar for ZeroLeak7 25. ZeroLeak7 Lv 1 18 pts. 20,607
  6. Avatar for infjamc 26. infjamc Lv 1 16 pts. 20,564
  7. Avatar for BootsMcGraw 27. BootsMcGraw Lv 1 15 pts. 20,558
  8. Avatar for BarrySampson 28. BarrySampson Lv 1 14 pts. 20,545
  9. Avatar for Phyx 29. Phyx Lv 1 12 pts. 20,520
  10. Avatar for fpc 30. fpc Lv 1 11 pts. 20,517

Comments