Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 21,038
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 21,032
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 20,854
  4. Avatar for Contenders 4. Contenders 36 pts. 20,854
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 20,809
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,754
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 20,658
  8. Avatar for VeFold 8. VeFold 6 pts. 20,457
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 20,451
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 20,426
  1. Avatar for Merf 51. Merf Lv 1 1 pt. 19,633
  2. Avatar for kentish_alex 52. kentish_alex Lv 1 1 pt. 19,607
  3. Avatar for CharaLilith 53. CharaLilith Lv 1 1 pt. 19,593
  4. Avatar for AlkiP0Ps 54. AlkiP0Ps Lv 1 1 pt. 19,527
  5. Avatar for Vinara 55. Vinara Lv 1 1 pt. 19,497
  6. Avatar for Arne Heessels 56. Arne Heessels Lv 1 1 pt. 19,419
  7. Avatar for RichGuilmain 57. RichGuilmain Lv 1 1 pt. 19,327
  8. Avatar for carxo 58. carxo Lv 1 1 pt. 19,216
  9. Avatar for sandy98 59. sandy98 Lv 1 1 pt. 19,179
  10. Avatar for kludbrook 60. kludbrook Lv 1 1 pt. 19,087

Comments