Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 21,038
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 21,032
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 20,854
  4. Avatar for Contenders 4. Contenders 36 pts. 20,854
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 20,809
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,754
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 20,658
  8. Avatar for VeFold 8. VeFold 6 pts. 20,457
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 20,451
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 20,426
  1. Avatar for Komeiji_Koishi 31. Komeiji_Koishi Lv 1 10 pts. 20,457
  2. Avatar for WBarme1234 32. WBarme1234 Lv 1 9 pts. 20,451
  3. Avatar for manu8170 33. manu8170 Lv 1 9 pts. 20,450
  4. Avatar for ShadowTactics 34. ShadowTactics Lv 1 8 pts. 20,426
  5. Avatar for Trajan464 35. Trajan464 Lv 1 7 pts. 20,382
  6. Avatar for blazegeek 36. blazegeek Lv 1 6 pts. 20,360
  7. Avatar for zippyc137 37. zippyc137 Lv 1 6 pts. 20,281
  8. Avatar for akaaka 38. akaaka Lv 1 5 pts. 20,257
  9. Avatar for alcor29 39. alcor29 Lv 1 5 pts. 20,178
  10. Avatar for Gonegirl 40. Gonegirl Lv 1 4 pts. 20,150

Comments