Placeholder image of a protein
Icon representing a puzzle

2221: Electron Density Reconstruction 15

Closed since over 3 years ago

Novice Overall Prediction Electron Density

Summary

Created
November 01, 2022
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.

Sequence
VESSTDGQVVPQEVLNLPLEKAHEEADDYLDHLLDSLEELSEAHPDCIPDVELSHGVMTLEIPAFGTYVINKQPPNKQIWLASPLSGPNRFDLLNGEWVSLRNGTKLTDILTEEVEKAISKSQ

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 21,038
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 73 pts. 21,032
  3. Avatar for Marvin's bunch 3. Marvin's bunch 52 pts. 20,854
  4. Avatar for Contenders 4. Contenders 36 pts. 20,854
  5. Avatar for Void Crushers 5. Void Crushers 24 pts. 20,809
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,754
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 20,658
  8. Avatar for VeFold 8. VeFold 6 pts. 20,457
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 4 pts. 20,451
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 20,426
  1. Avatar for CFirmalalala 71. CFirmalalala Lv 1 1 pt. 18,628
  2. Avatar for DipsyDoodle2016 72. DipsyDoodle2016 Lv 1 1 pt. 18,574
  3. Avatar for vyndaquel 73. vyndaquel Lv 1 1 pt. 18,373
  4. Avatar for Sammy3c2b1a0 74. Sammy3c2b1a0 Lv 1 1 pt. 18,250
  5. Avatar for Bautho 75. Bautho Lv 1 1 pt. 17,856
  6. Avatar for DScott 76. DScott Lv 1 1 pt. 17,364
  7. Avatar for robgee 77. robgee Lv 1 1 pt. 16,579
  8. Avatar for RubiscoBob 78. RubiscoBob Lv 1 1 pt. 16,455
  9. Avatar for Relva0309 79. Relva0309 Lv 1 1 pt. 8,941
  10. Avatar for spvincent 80. spvincent Lv 1 1 pt. 8,843

Comments